PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0254s00140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 137aa    MW: 15499.7 Da    PI: 4.3305
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0254s00140.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.47.7e-09333131
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartm 31
                      +g+WT+ Ed ll ++++ +G g+Wk+ +++ 
  Vang0254s00140.1  3 KGPWTPKEDALLTKYIQAHGEGQWKSLPKKA 33
                      79************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.427143IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.8E-10233IPR009057Homeodomain-like
SuperFamilySSF466895.02E-7232IPR009057Homeodomain-like
PfamPF002491.1E-6332IPR001005SANT/Myb domain
CDDcd001675.66E-5532No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
LHKGPWTPKE DALLTKYIQA HGEGQWKSLP KKADSNNTYT FDSNSASAST NQEKEESPLT  60
KESNLASEFR NVGESDDFGF FSEDHDLVNA SDMECHSYFP SDHGSLQQLY EEYYHLLNMD  120
HSQFIEMSSF GESLFT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150421e-174AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014524093.15e-66PREDICTED: transcription repressor MYB6-like
TrEMBLA0A0L9T5U71e-69A0A0L9T5U7_PHAAN; Uncharacterized protein
STRINGGLYMA16G02570.12e-47(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2714733
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.14e-11myb domain protein 111